PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490702.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 249aa    MW: 27606.2 Da    PI: 9.3737
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490702.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.66.9e-41601591100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll ++pe +r da++s+vyeA+ r+rdP+yG++g i++lqqq+++l+ael+
  XP_004490702.1  60 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKLLMEVPEGQRGDAANSMVYEANLRLRDPIYGCMGAISSLQQQVQSLQAELQ 154
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_004490702.1 155 AIRAE 159
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.07659160IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-4160157IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MHLNQNFPSS QPPLRSRKKK HVWMSRDRLD ELEKVNSEGE TSLQMGRKHF YGTTLNTVTP  60
CAACKLLRRR CAEECPFSPY FSPHEPQKFA AVHKVFGASN VSKLLMEVPE GQRGDAANSM  120
VYEANLRLRD PIYGCMGAIS SLQQQVQSLQ AELQAIRAEI LKYKYREATN FISSNHSTLV  180
SSMPNSTQNS SQPLSSSSSS LPLPKLLPSH ESIILSSLSS SSASNSVYTS NKSTMSHGSI  240
SSENIPYFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1438891e-120BT143889.1 Medicago truncatula clone JCVI-FLMt-13L16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490702.10.0PREDICTED: LOB domain-containing protein 15 isoform X1
TrEMBLV7BB151e-107V7BB15_PHAVU; Uncharacterized protein
STRINGGLYMA14G38280.22e-97(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-62LOB domain-containing protein 13